Mouse Anti-MEDAG Antibody (CBMOAB-51115FYA)


Cat: CBMOAB-51115FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51115FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO51115FYA 100 µg
MO-AB-11990W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11990W 100 µg
MO-AB-15536R Monoclonal Cattle (Bos taurus) WB, ELISA MO15536R 100 µg
MO-AB-58954W Monoclonal Marmoset WB, ELISA MO58954W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO51115FYA
SpecificityThis antibody binds to Rhesus MEDAG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMEDAG (Mesenteric Estrogen Dependent Adipogenesis) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus MEDAG Antibody is a mouse antibody against MEDAG. It can be used for MEDAG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMEDAG
UniProt IDF6XBE5
Protein RefseqThe length of the protein is 263 amino acids long.
The sequence is show below: MAGAACEPVARPSLTSISSGELRSLWTCDCELALLPLAQLLRLQPGAFQLRGDQLVVAGPGEPAAARGGFNVFGDGLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDSSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESYRLQFDFQEAVKNFFPPGNEVVHGENLSFAYEFKADALFDFFYWFGLSNSVVKVNGKVLNLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRG.
For Research Use Only | Not For Clinical Use.
Online Inquiry