Mouse Anti-MEPCE Antibody (CBMOAB-51155FYA)


Cat: CBMOAB-51155FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51155FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human, Mouse, Rat, Zebrafish, Marmoset, Zebrafish (Danio rerio) WB, ELISA MO51155FYA 100 µg
CBMOAB-86551FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86551FYA 100 µg
MO-AB-04382W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04382W 100 µg
MO-AB-18777W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18777W 100 µg
MO-AB-58985W Monoclonal Marmoset WB, ELISA MO58985W 100 µg
MO-MMB-0049 Polyclonal Human, Mouse, Rat, Zebrafish WB, IHC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human, Mouse, Rat, Zebrafish, Marmoset, Zebrafish (Danio rerio)
CloneMO51155FYA
SpecificityThis antibody binds to Rhesus MEPCE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MEPCE Antibody is a mouse antibody against MEPCE. It can be used for MEPCE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMEPCE
UniProt IDF7EXI8
Protein RefseqThe length of the protein is 220 amino acids long.
The sequence is show below: MVGLDIDSRLIHSARQNIRHYLSEELRLPPQTVEGDPGAEGEEGTTTVRKRSCFPASLTASRGPIAAPQVPLDGADTSVFPNNVVFVTGNYVLDRDDLVEAQTPEYDVVLCLSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYGKRKTLTETIYKNYYRIQLKPEQFSSYLTSPDVGFSSYELVATPHNTSKGFQRPVYLFHKARSPSH.
For Research Use Only | Not For Clinical Use.
Online Inquiry