AibGenesis™ Mouse Anti-METTL10 Antibody (CBMOAB-51173FYA)


Cat: CBMOAB-51173FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51173FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO51173FYA 100 µg
CBMOAB-86595FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86595FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO51173FYA
SpecificityThis antibody binds to Rhesus METTL10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProtein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-318'. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus METTL10 Antibody is a mouse antibody against METTL10. It can be used for METTL10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMETTL10
UniProt IDF6VWE5
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: AKFGFSDITGIDYSPSAIQLSGSVIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFLITSCNWTKEELLNEFSEDWSTVAGFWLTAALTSWAQEILSLQPPVAGTTGTHHHAWIIFIFLVETGFCHAVQAGLELLGSSDSPTPPKVLGLHHARPWLAF.
For Research Use Only | Not For Clinical Use.
Online Inquiry