AibGenesis™ Mouse Anti-MFAP3 Antibody (CBMOAB-51210FYA)


Cat: CBMOAB-51210FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51210FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO51210FYA 100 µg
MO-AB-15598R Monoclonal Cattle (Bos taurus) WB, ELISA MO15598R 100 µg
MO-AB-19215W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19215W 100 µg
MO-AB-59015W Monoclonal Marmoset WB, ELISA MO59015W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO51210FYA
SpecificityThis antibody binds to Rhesus MFAP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MFAP3 Antibody is a mouse antibody against MFAP3. It can be used for MFAP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMFAP3
UniProt IDF7H222
Protein RefseqThe length of the protein is 362 amino acids long.
The sequence is show below: MKLHCCLFTLVASIIVPAAFVLEDVDFNQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRGRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDMSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDMGSAESNSNYKDGAYENCQL.
For Research Use Only | Not For Clinical Use.
Online Inquiry