Mouse Anti-MGARP Antibody (CBMOAB-51249FYA)


Cat: CBMOAB-51249FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51249FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO51249FYA 100 µg
MO-AB-15621R Monoclonal Cattle (Bos taurus) WB, ELISA MO15621R 100 µg
MO-AB-26721W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26721W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO51249FYA
SpecificityThis antibody binds to Rhesus MGARP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MGARP Antibody is a mouse antibody against MGARP. It can be used for MGARP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGARP
UniProt IDF6Z4A2
Protein RefseqThe length of the protein is 279 amino acids long.
The sequence is show below: MYLRRAVSKTLALPLRAPPNPAPLGKDASLRRMSSNRFPGSSGSNMIYYLVVGVTVSAGGYYAYKTVTSDQAKHTEHITDLKEKTKAEIHPFQGEKENVAETEKASSEAPEVLAVEAEVVDAEESPGATVVVIKEASACPGHVEAAPETTAVSAETGPEVTDAAARETAEVNPETTPEVTNAALDEAVTIDNDKDTTENESSDEYAELEEENSPAESESSAGDDLQEEASVGSEAASAQANLQLVDISATNAIECLISAFVFLVHLVYKKKKKTFSRKC.
For Research Use Only | Not For Clinical Use.
Online Inquiry