AibGenesis™ Mouse Anti-MIF4GD Antibody (CBMOAB-51435FYA)


Cat: CBMOAB-51435FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51435FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO51435FYA 100 µg
MO-AB-04417W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04417W 100 µg
MO-AB-15800R Monoclonal Cattle (Bos taurus) WB, ELISA MO15800R 100 µg
MO-AB-17617W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17617W 100 µg
MO-AB-27090H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27090C 100 µg
MO-AB-59107W Monoclonal Marmoset WB, ELISA MO59107W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO51435FYA
SpecificityThis antibody binds to Rhesus MIF4GD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which interacts with the N-terminus of the stem-loop binding protein (SLBP) and the 3' end of histone mRNA. This interaction facilitates the activation of histone mRNA translation. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus MIF4GD Antibody is a mouse antibody against MIF4GD. It can be used for MIF4GD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMIF4GD
UniProt IDF7FJH3
Protein RefseqThe length of the protein is 222 amino acids long.
The sequence is show below: MGEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry