AibGenesis™ Mouse Anti-MINOS1 Antibody (CBMOAB-51440FYA)


Cat: CBMOAB-51440FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51440FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO51440FYA 100 µg
CBMOAB-86955FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86955FYA 100 µg
MO-AB-05183H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05183C 100 µg
MO-AB-18609W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18609W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO51440FYA
SpecificityThis antibody binds to Rhesus MINOS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMINOS1 (Mitochondrial Inner Membrane Organizing System 1) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus MINOS1 Antibody is a mouse antibody against MINOS1. It can be used for MINOS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMINOS1
UniProt IDF6TSY6
Protein RefseqThe length of the protein is 78 amino acids long.
The sequence is show below: MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry