Mouse Anti-MOB1A Antibody (CBMOAB-51556FYA)


Cat: CBMOAB-51556FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51556FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO51556FYA 100 µg
CBMOAB-87167FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87167FYA 100 µg
MO-AB-05245H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05245C 100 µg
MO-AB-15894R Monoclonal Cattle (Bos taurus) WB, ELISA MO15894R 100 µg
MO-AB-23627W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23627W 100 µg
MO-AB-27133H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27133C 100 µg
MO-AB-59204W Monoclonal Marmoset WB, ELISA MO59204W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO51556FYA
SpecificityThis antibody binds to Rhesus MOB1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus MOB1A Antibody is a mouse antibody against MOB1A. It can be used for MOB1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMOB1A
UniProt IDF6SLK3
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: MSFLFSSCSSKTFKLKKNIPEGSHQYELLKHAEATLGSENLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYGHIYHQHFDSVMQLQEEAHLNTSFKHFIFFDQEFNLIDRCELAPLQELIETFGSKDR.
For Research Use Only | Not For Clinical Use.
Online Inquiry