AibGenesis™ Mouse Anti-MOK Antibody (CBMOAB-51576FYA)


Cat: CBMOAB-51576FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51576FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO51576FYA 100 µg
MO-AB-04455W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04455W 100 µg
MO-AB-05261H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05261C 100 µg
MO-AB-27145H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27145C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO51576FYA
SpecificityThis antibody binds to Rhesus MOK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the MAP kinase superfamily. The gene was found to be regulated by caudal type transcription factor 2 (Cdx2) protein. The encoded protein, which is localized to epithelial cells in the intestinal crypt, may play a role in growth arrest and differentiation of cells of upper crypt and lower villus regions. Multiple alternatively spliced transcript variants encoding different isoforms have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus MOK Antibody is a mouse antibody against MOK. It can be used for MOK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMOK
UniProt IDF7DNC0
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: FIDYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILTLHEVVFDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIA.
For Research Use Only | Not For Clinical Use.
Online Inquiry