AibGenesis™ Mouse Anti-MORF4L2 Antibody (CBMOAB-51586FYA)


Cat: CBMOAB-51586FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51586FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset WB, ELISA MO51586FYA 100 µg
MO-AB-15922R Monoclonal Cattle (Bos taurus) WB, ELISA MO15922R 100 µg
MO-AB-24743W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24743W 100 µg
MO-AB-35133W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35133W 100 µg
MO-AB-59237W Monoclonal Marmoset WB, ELISA MO59237W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset
CloneMO51586FYA
SpecificityThis antibody binds to Rhesus MORF4L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MORF4L2 Antibody is a mouse antibody against MORF4L2. It can be used for MORF4L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMortality factor 4-like protein 2; MORF4L2
UniProt IDH9F223
Protein RefseqThe length of the protein is 195 amino acids long.
The sequence is show below: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLG.
For Research Use Only | Not For Clinical Use.
Online Inquiry