AibGenesis™ Mouse Anti-MORN4 Antibody (CBMOAB-51588FYA)
Cat: CBMOAB-51588FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-51588FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO51588FYA | 100 µg | ||
| CBMOAB-87216FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87216FYA | 100 µg | ||
| MO-AB-15925R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15925R | 100 µg | ||
| MO-AB-25465W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25465W | 100 µg | ||
| MO-AB-27152H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27152C | 100 µg | ||
| MO-AB-35134W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35134W | 100 µg | ||
| MO-AB-59239W | Monoclonal | Marmoset | WB, ELISA | MO59239W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO51588FYA |
| Specificity | This antibody binds to Rhesus MORN4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | MORN4 (MORN Repeat Containing 4) is a Protein Coding gene. |
| Product Overview | Mouse Anti-Rhesus MORN4 Antibody is a mouse antibody against MORN4. It can be used for MORN4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | MORN4 |
| UniProt ID | F7EGA1 |
| Protein Refseq | The length of the protein is 72 amino acids long. The sequence is show below: MTLTKGSFTYSSGEEYRGEWKEGEKDPWGVSNDEHFICWRTNTSANVASFMGFHFQLQDLIPHSACLSFIPF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry