AibGenesis™ Mouse Anti-MOSPD1 Antibody (CBMOAB-51592FYA)


Cat: CBMOAB-51592FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51592FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO51592FYA 100 µg
CBMOAB-87222FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87222FYA 100 µg
MO-AB-15927R Monoclonal Cattle (Bos taurus) WB, ELISA MO15927R 100 µg
MO-AB-18663W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18663W 100 µg
MO-AB-27153H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27153C 100 µg
MO-AB-27351R Monoclonal Pig (Sus scrofa) WB, ELISA MO27351R 100 µg
MO-AB-59240W Monoclonal Marmoset WB, ELISA MO59240W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO51592FYA
SpecificityThis antibody binds to Rhesus MOSPD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MOSPD1 Antibody is a mouse antibody against MOSPD1. It can be used for MOSPD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMOSPD1
UniProt IDF6YW20
Protein RefseqThe length of the protein is 214 amino acids long.
The sequence is show below: MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRIKEHLTESLFFEQSFQPGKNRAVSSGPSLLTVFLGVVCIAALMLPTMGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT.
For Research Use Only | Not For Clinical Use.
Online Inquiry