AibGenesis™ Mouse Anti-MOSPD3 Antibody (CBMOAB-51596FYA)


Cat: CBMOAB-51596FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51596FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO51596FYA 100 µg
MO-AB-05268H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05268C 100 µg
MO-AB-15929R Monoclonal Cattle (Bos taurus) WB, ELISA MO15929R 100 µg
MO-AB-22881W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22881W 100 µg
MO-AB-27154H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27154C 100 µg
MO-AB-27353R Monoclonal Pig (Sus scrofa) WB, ELISA MO27353R 100 µg
MO-AB-37690W Monoclonal Goat (Capra hircus) WB, ELISA MO37690W 100 µg
MO-AB-59242W Monoclonal Marmoset WB, ELISA MO59242W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO51596FYA
SpecificityThis antibody binds to Rhesus MOSPD3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. (From NCBI)
Product OverviewMouse Anti-Rhesus MOSPD3 Antibody is a mouse antibody against MOSPD3. It can be used for MOSPD3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMOSPD3
UniProt IDF7GZX9
Protein RefseqThe length of the protein is 230 amino acids long.
The sequence is show below: MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRACRAEGRGDSNDPHGRACLCVVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSVLRAPAYPLELQGQPDPAPHPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLQDELSSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRT.
For Research Use Only | Not For Clinical Use.
Online Inquiry