AibGenesis™ Mouse Anti-MPND Antibody (CBMOAB-51629FYA)


Cat: CBMOAB-51629FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51629FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO51629FYA 100 µg
CBMOAB-87259FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87259FYA 100 µg
MO-AB-04463W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04463W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO51629FYA
SpecificityThis antibody binds to Rhesus MPND.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MPND Antibody is a mouse antibody against MPND. It can be used for MPND detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMPND
UniProt IDF6YHT9
Protein RefseqThe length of the protein is 496 amino acids long.
The sequence is show below: PEPLSPAGGAGEEAPEEDEDEAEAEDPERPNAGAGGGRSGGGGCSSGSGGGGGGAGAGGCGGPGGAFTRRAVTLRVLLKDALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQIFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADEKAVRGGFPEKVTFEQRTEGIFGSVSARFTDRSDAGACTTTPSGHLATTPGKRVDSKIRVPVHYCMLGSRDSARNPHTLVEVTSFAAINKFQPFNVAVSSNVLFLLDFHSHLTRSEVVGYLGGRWDINSQVGIQGQVGRGRWGTRETAAAIEEEVYQSLFLRGLSLVGWYHSHPHSPALPSLQDIDAQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEQRPSDYGIPMDVEMAYVQDSFLTNDILHEMMLLVEFYKGAPDLVRLQEPWSQEHTYLDKLKISLASRTPKDQSLCHVLEQVCGILKQGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry