Mouse Anti-MRGPRG Antibody (CBMOAB-51683FYA)


Cat: CBMOAB-51683FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51683FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris) WB, ELISA MO51683FYA 100 µg
MO-AB-31819W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31819W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris)
CloneMO51683FYA
SpecificityThis antibody binds to Rhesus MRGPRG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MRGPRG Antibody is a mouse antibody against MRGPRG. It can be used for MRGPRG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMRGPRG
UniProt IDF7C3V0
Protein RefseqThe length of the protein is 320 amino acids long.
The sequence is show below: RCSKFHPNRRQAMSAGLSREGPERAEGSLVTGEKALSAPTAPPSVVFYLTLIVGLGGLVGNGLVLWNLGFHIKKGPFSVYLLHLAAADFLFLSCHMGFSVAQAALDAQDTLYFVLTFLWFAVGLWLLAAFSVERCLSNLFPTCYQGCWPRHASAILCALVWALTLPAVLLPANACGLLRNSTRLLVCLRYHVASVIWLLVLACVACTAGVVLFVWVTCCSTRPRPRLYGIVLGALFLFFFCGLPLVLYWSLQPLLNFLLHFLLPMFLPLATLLACINSSSKPLIYLASGRQPGKREPLRVVLRRALGEGAELGARGQSLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry