Mouse Anti-MS4A10 Antibody (CBMOAB-51791FYA)


Cat: CBMOAB-51791FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51791FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO51791FYA 100 µg
MO-AB-27247H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27247C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO51791FYA
SpecificityThis antibody binds to Rhesus MS4A10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MS4A10 Antibody is a mouse antibody against MS4A10. It can be used for MS4A10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMS4A10
UniProt IDF7HTQ0
Protein RefseqThe length of the protein is 268 amino acids long.
The sequence is show below: MKAEATVIPSHCARGLPSWQVLSPVQPWQTSPPQSTTQPKLLARRHKKSQKRSSLLKELGAFHITIALLHLVFGGYLASTVKSLHLVVLKSWYPFWGAASFLISGILAITMKKFSKTYLKMLCLIANLISLFCVLSGLFVITKDLFLESPFESPIWRMHPNSTVHIQRLELALLCFTVLELFLPVPVAVTAWRGDRPSAKNDDACLVPNPPLHLTGLPVEPPPSYQSVIQQDTQHKQPQSSEVRRIQDPSCDIEVASKTSASGFQTSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry