AibGenesis™ Mouse Anti-MSANTD1 Antibody (MO-AB-04486W)


Cat: MO-AB-04486W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04486W Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO04486W 100 µg
Inquiry
MO-AB-59417W Monoclonal Marmoset WB, ELISA MO59417W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO04486W
SpecificityThis antibody binds to Rhesus MSANTD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MSANTD1 Antibody is a mouse antibody against MSANTD1. It can be used for MSANTD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyb / SANT DNA Binding Domain Containing 1; Myb / SANT-Like DNA-Binding Domain Containing 1; C4orf44; Myb / SANT-Like DNA-Binding Domain-Containing Protein 1; Chromosome 4 Open Reading Frame 44
UniProt IDF6VJR2
Protein RefseqThe length of the protein is 258 amino acids long.
The sequence is show below: MVRGAGPGASLSLSHPPGAWSMAAAEGPGYLVSPQAEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLKCMTDSESAPPDWPYYLAIDGILAKVPESWGGLAPPLHMEYETVSDLTPWGLQFPHLPRSGEGPGVPRLCGQHVHSWRYPSRSEERPVKKRKVQSCHLQKKQLRLLEAMVEEQRRLSRAVEETCREISCCYSTVCRRGCHVAMEWLWTLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry