AibGenesis™ Mouse Anti-MTERFD1 Antibody (CBMOAB-51855FYA)


Cat: CBMOAB-51855FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51855FYA Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO51855FYA 100 µg
MO-AB-59476W Monoclonal Marmoset WB, ELISA MO59476W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO51855FYA
SpecificityThis antibody binds to Rhesus MTERFD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MTERFD1 Antibody is a mouse antibody against MTERFD1. It can be used for MTERFD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesmTERF domain-containing protein 1, mitochondrial; MTERFD1
UniProt IDH9EX20
Protein RefseqThe length of the protein is 417 amino acids long.
The sequence is show below: MALSAQQIPRWFNAAKLRSLINAVQLTKCFARPGRTLLHGFSAQPQISSDNCFLQWGFKTYKTSSLWNSSQSTSSSSQENNSTQSSLLPSMNEQSQKTQKIPSFDSELFLEELDELPPLSPMQPISEEEAIQIIADPPLPPASFTLRDYVDHSETLQKLVLLGVDLSKIEKHTEAANLLLRLDFEKDIKQMLLFLKDVGIEDNQLGAFLTKNHAIFSEDLENLKIRVAYLLSKNFSKADVAQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLVVRLPRLLTGSLEPVKENMKVYRLELGFKHNEIQHMITRIPKMLTANKRKLTETFDFVHNVMSIPHHIIVKFPQVFNTRLFKIKERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCEEIAKASVQDFDKFLKTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry