AibGenesis™ Mouse Anti-MTNR1B Antibody (CBMOAB-51905FYA)
Cat: CBMOAB-51905FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-51905FYA | Monoclonal | Rhesus (Macaca mulatta), Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO51905FYA | 100 µg | ||
| MO-AB-27297H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27297C | 100 µg | ||
| MO-AB-27391R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27391R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Pig (Sus scrofa), Rat (Rattus norvegicus) |
| Clone | MO51905FYA |
| Specificity | This antibody binds to Rhesus MTNR1B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This gene product is an integral membrane protein that is a G-protein coupled, 7-transmembrane receptor. It is found primarily in the retina and brain although this detection requires RT-PCR. It is thought to participate in light-dependent functions in the retina and may be involved in the neurobiological effects of melatonin. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus MTNR1B Antibody is a mouse antibody against MTNR1B. It can be used for MTNR1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Melatonin receptor 1B; MTNR1B |
| UniProt ID | Q8SPP0 |
| Protein Refseq | The length of the protein is 58 amino acids long. The sequence is show below: SYLLAYFNSCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASMGSHVEGLQSPAP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry