Mouse Anti-MXD4 Antibody (CBMOAB-51978FYA)
Cat: CBMOAB-51978FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-51978FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) | WB, ELISA | MO51978FYA | 100 µg | ||
| MO-AB-05385H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05385C | 100 µg | ||
| MO-AB-16259R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16259R | 100 µg | ||
| MO-AB-16302W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16302W | 100 µg | ||
| MO-AB-27315H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27315C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) |
| Clone | MO51978FYA |
| Specificity | This antibody binds to Rhesus MXD4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is a member of the MAD gene family. The MAD genes encode basic helix-loop-helix-leucine zipper proteins that heterodimerize with MAX protein, forming a transcriptional repression complex. The MAD proteins compete for MAX binding with MYC, which heterodimerizes with MAX forming a transcriptional activation complex. Studies in rodents suggest that the MAD genes are tumor suppressors and contribute to the regulation of cell growth in differentiating tissues. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus MXD4 Antibody is a mouse antibody against MXD4. It can be used for MXD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | MXD4 |
| UniProt ID | F6RPL8 |
| Protein Refseq | The length of the protein is 76 amino acids long. The sequence is show below: MTTTGSSDPNPGSQEKGVDRGRKEGKAVCPSVRLSTYLSVHIGSWRGQGICEGRDLGEHLGQVGGQGPSHVAGVRT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry