AibGenesis™ Mouse Anti-MYMK Antibody (MO-AB-04545W)


Cat: MO-AB-04545W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04545W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish WB, ELISA MO04545W 100 µg
MO-AB-18459W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18459W 100 µg
MO-AB-27352H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27352C 100 µg
MOFY-1222-FY70 Polyclonal Zebrafish WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish
CloneMO04545W
SpecificityThis antibody binds to Rhesus MYMK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Golgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MYMK Antibody is a mouse antibody against MYMK. It can be used for MYMK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyomaker, Myoblast Fusion Factor; Transmembrane Protein 226; Transmembrane Protein 8C; Myoblast Fusion Maker; TMEM226; TMEM8C; Protein Myomaker; MYOMAKER
UniProt IDG7NF98
Protein RefseqThe length of the protein is 221 amino acids long.
The sequence is show below: MGTLVAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTLFFVALHHACNGPGLSVLCFMRHDILEYFSVYGTALSMWVSLMALADFDEPKRSTFVMFGVLTIAVRIYHDRWGYGVYSGPIGTAILIIAAKWLQKMKEKKGLYPDKSVYTQQIGPGLCFGALALMLRFFFEDWDYTYVHSFYHCALAMSFVLLLPKVNKKAGAPGAPAKLDCSTLCCACV.
For Research Use Only | Not For Clinical Use.
Online Inquiry