AibGenesis™ Mouse Anti-MYPOP Antibody (CBMOAB-52113FYA)


Cat: CBMOAB-52113FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52113FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO52113FYA 100 µg
MO-AB-13859W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13859W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO52113FYA
SpecificityThis antibody binds to Rhesus MYPOP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MYPOP Antibody is a mouse antibody against MYPOP. It can be used for MYPOP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyb-related transcription factor, partner of profilin; MYPOP
UniProt IDH9FKT5
Protein RefseqThe length of the protein is 116 amino acids long.
The sequence is show below: EETTRLRKPRFSFEENQILIREVRAHYPQLYGAQSRRVSVAERRRVWDGIAAKINGITSWKRTGQEVQKRWNDFKRRTKEKLARVPHSTQGAGPAAEDAFSAEEETIFAILGPGVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry