AibGenesis™ Mouse Anti-NANOS2 Antibody (CBMOAB-52220FYA)


Cat: CBMOAB-52220FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52220FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Medaka (Oryzias latipes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52220FYA 100 µg
CBMOAB-88334FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88334FYA 100 µg
MO-AB-00951R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00951R 100 µg
MO-AB-16369R Monoclonal Cattle (Bos taurus) WB, ELISA MO16369R 100 µg
MO-AB-27380H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27380C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Medaka (Oryzias latipes), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52220FYA
SpecificityThis antibody binds to Rhesus NANOS2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the female fate. Represses the female fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for premeiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial stem cell population. Not essential for the assembly of P-bodies but is required for the maintenance of their normal state. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus NANOS2 Antibody is a mouse antibody against NANOS2. It can be used for NANOS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNanos homolog 2; NANOS2
UniProt IDI2CV33
Protein RefseqThe length of the protein is 138 amino acids long.
The sequence is show below: MQLPPFDMWKDYFNLSQVVWALIANRGQKLETQETEEPSPGPPLGQDQGLGGSGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR.
For Research Use Only | Not For Clinical Use.
Online Inquiry