Mouse Anti-NIFK Antibody (CBMOAB-52646FYA)


Cat: CBMOAB-52646FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52646FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO52646FYA 100 µg
CBMOAB-89009FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89009FYA 100 µg
MO-AB-04727W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04727W 100 µg
MO-AB-14027W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14027W 100 µg
MO-AB-16741R Monoclonal Cattle (Bos taurus) WB, ELISA MO16741R 100 µg
MO-AB-60065W Monoclonal Marmoset WB, ELISA MO60065W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO52646FYA
SpecificityThis antibody binds to Rhesus NIFK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19. (From NCBI)
Product OverviewMouse Anti-Rhesus NIFK Antibody is a mouse antibody against NIFK. It can be used for NIFK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNIFK
UniProt IDF7H4N1
Protein RefseqThe length of the protein is 293 amino acids long.
The sequence is show below: MAAFSGPAGPILSLNPQEDAEFQKEVAQVRKRITQRKKQERLTSGVVYVGHLPNLLNETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSHPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTEGVSKTNRQTSTKGQVLRKKKKKVLGTPNVPEKTVDSQGPTPVCTPTFLERRKSEVAELNDDDKDNEIVFKEPISCVKEEIQETQTPTHSRKKRRRKSNQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry