AibGenesis™ Mouse Anti-NIPAL1 Antibody (CBMOAB-52655FYA)


Cat: CBMOAB-52655FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52655FYA Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO52655FYA 100 µg
MO-AB-60079W Monoclonal Marmoset WB, ELISA MO60079W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO52655FYA
SpecificityThis antibody binds to Rhesus NIPAL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActs as a Mg(2+) transporter. Can also transport other divalent cations such as Fe(2+), Sr(2+), Ba(2+), Mn(2+), Cu(2+) and Co(2+) but to a much less extent than Mg(2+). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus NIPAL1 Antibody is a mouse antibody against NIPAL1. It can be used for NIPAL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNIPAL1
UniProt IDF7ADN8
Protein RefseqThe length of the protein is 410 amino acids long.
The sequence is show below: MGAQVRLPPGEPCQEGYVLSLVCPNSFQAWCEITNVSQLLASPVLYTDLNSSINNLSISANVENKYSLYVGLVLAVSSSIFIGSSFILKKKGLLQLASKGVTRAGQGGHSYLKEWLWWVGLLSMGAGEAANFAAYAFAPATLVTPLGALSVLISAILSSYFLNEHLNIHGKIGCILSILGSTVMVIHAPQEEEVTSLHEMEMKLRDPGFISFAVIITVISLVLILIVAPKKGQTNILVYISICSLIGAFSVSSVKGLGIAIKELIEWKPVYKHPLVFVLLAVLVLSVTTQINYLNKALDTFNTSLVTPIYYVFFTSMVVTCSAVLFQEWYGMTAGDIIGTLSGFFTIIIGIFLLHAFKNTDITWSELTSTAKKEAISLNVNENNYVLLENLECSAPGYNDDVTLFSRTDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry