Mouse Anti-NKAP Antibody (CBMOAB-52685FYA)


Cat: CBMOAB-52685FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52685FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO52685FYA 100 µg
CBMOAB-89359FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89359FYA 100 µg
MO-AB-05640H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05640C 100 µg
MO-AB-13120W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13120W 100 µg
MO-AB-16756R Monoclonal Cattle (Bos taurus) WB, ELISA MO16756R 100 µg
MO-AB-60092W Monoclonal Marmoset WB, ELISA MO60092W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO52685FYA
SpecificityThis antibody binds to Rhesus NKAP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is involved in the activation of the ubiquitous transcription factor NF-kappaB. This protein is associated with the the histone deacetylase HDAC3 and with the Notch corepressor complex, and it thereby acts as a transcriptional repressor of Notch target genes. It is also required for alphabeta T cell development. A related pseudogene has been identified on chromosome X, while a related and intronless retrocopy, which has an intact CDS and may be functional, is located on chromosome 6. (From NCBI)
Product OverviewMouse Anti-Rhesus NKAP Antibody is a mouse antibody against NKAP. It can be used for NKAP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNF-kappa-B-activating protein; NKAP
UniProt IDH9FC58
Protein RefseqThe length of the protein is 176 amino acids long.
The sequence is show below: KKKKHRSKKYKKKKSKKSRKESSDSSSKESQEEFLENPWKDRTKAEEPSDLIGPEAPKTLTSQDDKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGKDDK.
For Research Use Only | Not For Clinical Use.
Online Inquiry