AibGenesis™ Mouse Anti-NKIRAS2 Antibody (CBMOAB-52720FYA)
Cat: CBMOAB-52720FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-52720FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Primat, Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO52720FYA | 100 µg | ||
| CBMOAB-89380FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO89380FYA | 100 µg | ||
| MO-AB-16772R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16772R | 100 µg | ||
| MO-AB-17862W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17862W | 100 µg | ||
| MO-AB-27496H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27496C | 100 µg | ||
| MO-AB-60104W | Monoclonal | Marmoset | WB, ELISA | MO60104W | 100 µg | ||
| MO-DKB-01345W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Primat, Rhesus (Macaca mulatta) | WB, IHC, IHC-P | 100 µg | |||
| MO-DKB-01421W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Primat, Rhesus (Macaca mulatta) | WB, IF | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Primat, Marmoset, Zebrafish (Danio rerio) |
| Clone | MO52720FYA |
| Specificity | This antibody binds to Rhesus NKIRAS2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and nuclear localization of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Rhesus NKIRAS2 Antibody is a mouse antibody against NKIRAS2. It can be used for NKIRAS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | NKIRAS2 |
| UniProt ID | F7BYD2 |
| Protein Refseq | The length of the protein is 171 amino acids long. The sequence is show below: MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDQVCLPPQPEEQGQWLLGWLKSCRSSFIILAPFQHLGLW. |
For Research Use Only | Not For Clinical Use.
Online Inquiry