AibGenesis™ Mouse Anti-NME6 Antibody (CBMOAB-52769FYA)
Cat: CBMOAB-52769FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-52769FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO52769FYA | 100 µg | ||
| CBMOAB-89506FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO89506FYA | 100 µg | ||
| MO-AB-00898L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00898L | 100 µg | ||
| MO-AB-01064R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01064R | 100 µg | ||
| MO-AB-05667H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05667C | 100 µg | ||
| MO-AB-08961Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08961Y | 100 µg | ||
| MO-AB-09550W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09550W | 100 µg | ||
| MO-AB-16339Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO16339Y | 100 µg | ||
| MO-AB-16799R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16799R | 100 µg | ||
| MO-AB-25610W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25610W | 100 µg | ||
| MO-AB-26996W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26996W | 100 µg | ||
| MO-AB-27509H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27509C | 100 µg | ||
| MO-AB-27767R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27767R | 100 µg | ||
| MO-AB-32179W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO32179W | 100 µg | ||
| MO-AB-35188W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35188W | 100 µg | ||
| MO-AB-45790W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45790W | 100 µg | ||
| MO-AB-60136W | Monoclonal | Marmoset | WB, ELISA | MO60136W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO52769FYA |
| Specificity | This antibody binds to Rhesus NME6. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus NME6 Antibody is a mouse antibody against NME6. It can be used for NME6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Nucleoside diphosphate kinase; EC 2.7.4.6; NME6 |
| UniProt ID | F7DSK4 |
| Protein Refseq | The length of the protein is 192 amino acids long. The sequence is show below: LSNGRSEMASILRSPQALQLTLALIKPDAVAHPLILEVRMNPKPLPHALGIATASEAVNSDLRRLSRSTERRFFYQRVVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVRYSPEGGVHYVAGTGDLGPA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry