Mouse Anti-NPFF Antibody (CBMOAB-52886FYA)


Cat: CBMOAB-52886FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52886FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO52886FYA 100 µg
MO-AB-16875R Monoclonal Cattle (Bos taurus) WB, ELISA MO16875R 100 µg
MO-AB-27539H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27539C 100 µg
MO-AB-60250W Monoclonal Marmoset WB, ELISA MO60250W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO52886FYA
SpecificityThis antibody binds to Rhesus NPFF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the FMRFamide related peptide (FARP) family of neuropeptides. The encoded preproprotein is proteolytically processed to generate multiple amidated peptides. These peptides may play a role in the regulation of heart rate and blood pressure and the modulation of morphine-induced antinociception. Patients with hypertension exhibit decreased expression of the encoded protein. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. (From NCBI)
Product OverviewMouse Anti-Rhesus NPFF Antibody is a mouse antibody against NPFF. It can be used for NPFF detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNPFF
UniProt IDF7H2M6
Protein RefseqThe length of the protein is 113 amino acids long.
The sequence is show below: MDSRQTAALLVLLLLIDQGCAEGPGGQQDHQLPAEEDSEPLLPQDAQTSGSLLRYLLQAMERPGRSQAFLFQPQRFGRNTRGSWSNERLSPRAGEGLNSEFWSLAAPQRFGKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry