Mouse Anti-NPNT Antibody (CBMOAB-52909FYA)


Cat: CBMOAB-52909FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52909FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO52909FYA 100 µg
CBMOAB-89769FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89769FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO52909FYA
SpecificityThis antibody binds to Rhesus NPNT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFunctional ligand of integrin alpha-8/beta-1 in kidney development. Regulates the expression of GDNF with integrin alpha-8/beta-1 which is essential for kidney development. May also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus NPNT Antibody is a mouse antibody against NPNT. It can be used for NPNT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNPNT
UniProt IDF7HPR6
Protein RefseqThe length of the protein is 563 amino acids long.
The sequence is show below: MDFLLALVLVSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVCQPRCKHGDCIGPNKCKCHPGYAGKTCNQDLNECGLMPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALTCSMANCQYGCDVVKGQIRCQCPSPGLQLAPDGRTCVDVDECATGRASCPRFRQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNIHGSYKCKCKEGYQGDGLTCVYIPKVMIEPSSPIHVPKGNGTILKGDGGHNNRIPDVGSTWWPPKTAYIPPIITDRPTSKPTTRPTPKPTPLPTPPPPLPTELRTPLPATTPERPTTRLTTIAPAASTPPGGITVDNRVQIDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLVHSCNFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGGKAARLVLPLGRLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHSAHGAALWGRNGGHGWRQTQITLRGADIKSVIFKGEKRRGYTGEIGLDDVSLKKGPCSEER.
For Research Use Only | Not For Clinical Use.
Online Inquiry