AibGenesis™ Mouse Anti-NT5C Antibody (CBMOAB-53056FYA)


Cat: CBMOAB-53056FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53056FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO53056FYA 100 µg
MO-AB-04820W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04820W 100 µg
MO-AB-13454W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13454W 100 µg
MO-AB-16982R Monoclonal Cattle (Bos taurus) WB, ELISA MO16982R 100 µg
MO-AB-27583H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27583C 100 µg
MO-AB-60391W Monoclonal Marmoset WB, ELISA MO60391W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO53056FYA
SpecificityThis antibody binds to Rhesus NT5C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5' deoxyribonucleotides (dNTP) and 2'(3')-dNTP and ribonucleotides, but not 5' ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in its preference for 5'-dNTP. It may be one of the enzymes involved in regulating the size of dNTP pools in cells. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus NT5C Antibody is a mouse antibody against NT5C. It can be used for NT5C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names5'(3')-deoxyribonucleotidase, cytosolic type; NT5C
UniProt IDI0FR96
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MARRLRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTEVFICTSPLLKYDHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTIRGDEETPRWEHILFTCCHNRHLVLPPTKRRLLSWSDNWREILDSKRGAAQRE.
For Research Use Only | Not For Clinical Use.
Online Inquiry