AibGenesis™ Mouse Anti-NTAN1 Antibody (CBMOAB-53073FYA)


Cat: CBMOAB-53073FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53073FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) WB, ELISA MO53073FYA 100 µg
CBMOAB-90173FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90173FYA 100 µg
MO-AB-05798H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05798C 100 µg
MO-AB-12283Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12283Y 100 µg
MO-AB-21636W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21636W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio)
CloneMO53073FYA
SpecificityThis antibody binds to Rhesus NTAN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene functions in a step-wise process of protein degradation through the N-end rule pathway. This protein acts as a tertiary destabilizing enzyme that deamidates N-terminal L-Asn residues on proteins to produce N-terminal L-Asp. L-Asp substrates are subsequently conjugated to L-Arg, which is recognized by specific E3 ubiquitin ligases and targeted to the proteasome. Pseudogenes of this gene are located on the long arms of chromosomes 8, 10 and 12. Alternative splicing results in multiple transcript variants that encode different protein isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus NTAN1 Antibody is a mouse antibody against NTAN1. It can be used for NTAN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNTAN1
UniProt IDF7GVW9
Protein RefseqThe length of the protein is 310 amino acids long.
The sequence is show below: MPLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTCHIVVLRHTGNGATCLTHCDGTDTKAEVPLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPIIYGIAVNIKTAEIYRASFQDRGPEEQLRAARTLAGGPMISIYDAETEQLRIGPYSWTPFPHVDFWLQQDDKQILENLSTSPLAEPPHFVEHIRSTLMFLKKYPSPTNTLFPGNKALLYKKNEDGLWEKISSPGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry