AibGenesis™ Mouse Anti-NXT2 Antibody (CBMOAB-53243FYA)


Cat: CBMOAB-53243FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53243FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO53243FYA 100 µg
CBMOAB-90417FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90417FYA 100 µg
MO-AB-04860W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04860W 100 µg
MO-AB-05854H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05854C 100 µg
MO-AB-12289Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12289Y 100 µg
MO-AB-17073R Monoclonal Cattle (Bos taurus) WB, ELISA MO17073R 100 µg
MO-AB-27628H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27628C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO53243FYA
SpecificityThis antibody binds to Rhesus NXT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a nuclear transport factor 2 (NTF2) domain, which plays an important role in the trafficking of macromolecules, ions, and small molecules between the cytoplasm and nucleus. This protein may also have a role in mRNA nuclear export. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus NXT2 Antibody is a mouse antibody against NXT2. It can be used for NXT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNXT2
UniProt IDF6XG98
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: VTNHGPALCTAGRGPRFAARLAGPNPLFCCRFLVPERTLSCEIARGGGLGFDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNVVSGLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHYFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry