Mouse Anti-NYAP2 Antibody (CBMOAB-53244FYA)


Cat: CBMOAB-53244FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53244FYA Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO53244FYA 100 µg
MO-AB-60532W Monoclonal Marmoset WB, ELISA MO60532W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO53244FYA
SpecificityThis antibody binds to Rhesus NYAP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NYAP2 Antibody is a mouse antibody against NYAP2. It can be used for NYAP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNYAP2
UniProt IDF6RNV0
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: MVNAAVNTYGAAPGGSRSRTPTSPLEELTSLFSSGRSLLRKSSSGRRSKESAEKSTEELKVRSHSTEPLPKLDNKERGHHGASSSREPVKAQEWDGTPGPPVVTSRLGRCSVSPTLLAGNHSSEPKVSCKLGRSASTSGVPPPSVAPLRQTSDLQQSQV.
For Research Use Only | Not For Clinical Use.
Online Inquiry