AibGenesis™ Mouse Anti-NYD-SP12 Antibody (CBMOAB-53254FYA)


Cat: CBMOAB-53254FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53254FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO53254FYA 100 µg
MO-AB-14597W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14597W 100 µg
MO-AB-27076W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO27076W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO53254FYA
SpecificityThis antibody binds to Rhesus NYD-SP12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NYD-SP12 Antibody is a mouse antibody against NYD-SP12. It can be used for NYD-SP12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSpermatogenesis associated 16; NYD-SP12
UniProt IDQ0R2W1
Protein RefseqThe length of the protein is 204 amino acids long.
The sequence is show below: MDAGSSRSLENAVNKIYHDQLVPKINTSKKMSTLAHPPNILEMPQEIKKNCGGKQVEITLERIKMTKSIKEKQSNDLEKAAFKRKAEGEEKPTRKKEAKIIELDNQLITMPLPHIPLKNIMDVEMKLVYIDEVGVRYEFVESFMSTGSQPTCRVAEIVDPLSVPNFSFLPQIDKWLQVALKDASSCYRQKKYALAAGQFRTALE.
For Research Use Only | Not For Clinical Use.
Online Inquiry