AibGenesis™ Mouse Anti-OCIAD2 Antibody (CBMOAB-53284FYA)


Cat: CBMOAB-53284FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53284FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO53284FYA 100 µg
CBMOAB-90455FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90455FYA 100 µg
MO-AB-05865H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05865C 100 µg
MO-AB-13495W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13495W 100 µg
MO-AB-17108R Monoclonal Cattle (Bos taurus) WB, ELISA MO17108R 100 µg
MO-AB-27647H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27647C 100 µg
MO-AB-60549W Monoclonal Marmoset WB, ELISA MO60549W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO53284FYA
SpecificityThis antibody binds to Rhesus OCIAD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus OCIAD2 Antibody is a mouse antibody against OCIAD2. It can be used for OCIAD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOCIAD2
UniProt IDF6U3W5
Protein RefseqThe length of the protein is 99 amino acids long.
The sequence is show below: MASASTRGNQDKDTHLPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLVYQGYLAANPRFGSLPKVARTACLPVRNAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry