AibGenesis™ Mouse Anti-ODF3L2 Antibody (CBMOAB-53308FYA)


Cat: CBMOAB-53308FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53308FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO53308FYA 100 µg
CBMOAB-90482FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90482FYA 100 µg
MO-AB-04887W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04887W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO53308FYA
SpecificityThis antibody binds to Rhesus ODF3L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ODF3L2 Antibody is a mouse antibody against ODF3L2. It can be used for ODF3L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesODF3L2
UniProt IDH9H5I1
Protein RefseqThe length of the protein is 212 amino acids long.
The sequence is show below: SPAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGLEVTPGPGAYSPEKVPPVRHRTPPAFTLGCRLPPKPLDTSAPAPNTYTMPPLWGSQIFTKPRSPSYTVVGRTPPVRPPQDPAEIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTMAAATPSRSGHRLPGRCC.
For Research Use Only | Not For Clinical Use.
Online Inquiry