Mouse Anti-OR10W1 Antibody (CBMOAB-53423FYA)


Cat: CBMOAB-53423FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53423FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Marmoset WB, ELISA MO53423FYA 100 µg
MO-AB-00927L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00927L 100 µg
MO-AB-08284W Monoclonal Cat (Felis catus) WB, ELISA MO08284W 100 µg
MO-AB-32377W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32377W 100 µg
MO-AB-60635W Monoclonal Marmoset WB, ELISA MO60635W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Marmoset
CloneMO53423FYA
SpecificityThis antibody binds to Rhesus OR10W1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR10W1 Antibody is a mouse antibody against OR10W1. It can be used for OR10W1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR10W1
UniProt IDF7D538
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: MEFVFLAYPSCPELRILSFIGVSLVYGLIITGNILVVVSIHTEARLCTPMYYFLGSLSGIEICYTAVVVPHILANTLQSEKTITLLGCATQMTFFIALGSADCFLLAVMAYDRYVAICHPLQYPLLMTLTLCVHLVVASVVSGLFLSLQLVAFIFSLPFCQTRDIEHFFCDVPPVMHLVCAQSHIHEQSVLVAAILAIAVPFFLITTSYTFIVAAVLKIRSAAGRHRAFSTCSSHLTVVLLQYGCCAFMYLRPSSSYHPKQDQFISLVYTLGTPLLNPLIYALRNSEMKGAIGRVLTRNCLSQNS.
For Research Use Only | Not For Clinical Use.
Online Inquiry