AibGenesis™ Mouse Anti-OR13D1 Antibody (CBMOAB-53431FYA)


Cat: CBMOAB-53431FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53431FYA Monoclonal Rhesus (Macaca mulatta), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus) WB, ELISA MO53431FYA 100 µg
MO-AB-00934L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00934L 100 µg
MO-AB-06671Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06671Y 100 µg
MO-AB-09093Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09093Y 100 µg
MO-AB-35232W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35232W 100 µg
MO-AB-42198W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42198W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus)
CloneMO53431FYA
SpecificityThis antibody binds to Rhesus OR13D1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR13D1 Antibody is a mouse antibody against OR13D1. It can be used for OR13D1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOR13D1
UniProt IDF7HSI6
Protein RefseqThe length of the protein is 189 amino acids long.
The sequence is show below: IDCALQMVVSLGLGSTECVLLALMAYDHYVAICNPLTYSIIMKRVLYVQMAAWSWIIGFLNSLVQTVLTMVLPFCGNNIIDHLTCEILALLKVICSDISMNVFIMTVESIIVLLVIPLLLIFISYILSSILRINSAEGRKKAFSTCSVHLTVVILFYGSALFMYVKPKSKFKKASDEIIGLSYGVITPM.
For Research Use Only | Not For Clinical Use.
Online Inquiry