Mouse Anti-OR1J1 Antibody (CBMOAB-53444FYA)


Cat: CBMOAB-53444FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53444FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO53444FYA 100 µg
MO-AB-09011W Monoclonal Cat (Felis catus) WB, ELISA MO09011W 100 µg
MO-AB-09100Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09100Y 100 µg
MO-AB-16483Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16483Y 100 µg
MO-AB-35237W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35237W 100 µg
MO-AB-38650W Monoclonal Gorilla WB, ELISA MO38650W 100 µg
MO-AB-42204W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42204W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO53444FYA
SpecificityThis antibody binds to Rhesus OR1J1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR1J1 Antibody is a mouse antibody against OR1J1. It can be used for OR1J1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR1J1
UniProt IDF6PIZ3
Protein RefseqThe length of the protein is 321 amino acids long.
The sequence is show below: MSPENQSSVSEFLLLGLPIQPEQQAVFFTLFLGMYLTTVLGNLLIILLIRLDSHLHNPVCFFLSHLALTDVYFSSVTVPKMMMNMQTQHLAIFYKGCISQTYFFIFFADLDSFLITSMAYDRYVAICHPLHYAIILGQSQHELVAGSWVIACACALLHTLLLAWLSFCADHIIPHFFCDLGALLKLSCSDTSLNQLAIFTAGLTAIMLPFLCILVSYGHTAVTILQIPSTNGICKALSTGGSHLSAVTLYYGTIIGLYFLPPSSNTNDKNIIASVIYTVVTPMLNPFIYSLRNKDIKGALRKLLSRSGAVAHACNLSTLGG.
For Research Use Only | Not For Clinical Use.
Online Inquiry