Mouse Anti-OR4D1 Antibody (MO-AB-04913W)


Cat: MO-AB-04913W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04913W Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus) WB, ELISA MO04913W 100 µg
MO-AB-07433W Monoclonal Cat (Felis catus) WB, ELISA MO07433W 100 µg
MO-AB-09120Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09120Y 100 µg
MO-AB-16554W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16554W 100 µg
MO-AB-35265W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35265W 100 µg
MO-AB-45881W Monoclonal Horse (Equus caballus) WB, ELISA MO45881W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus)
CloneMO04913W
SpecificityThis antibody binds to Rhesus OR4D1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR4D1 Antibody is a mouse antibody against OR4D1. It can be used for OR4D1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR4D1
UniProt IDG7NHR5
Protein RefseqThe length of the protein is 310 amino acids long.
The sequence is show below: MEPQNTTQVSMFVLLGFSQTQELQKLLFLLFLFVYVTTIVGNLLIMVTVTFDCQLHTPMYFLLRNLALIDLCYSTVTSPKMLVDFLHETKTISYQGCMAQIFFFHLLGGGTVFFLSVMAYDRYIAISQPLHYVTIMNTQLCVGLVVATWVGGFVHAIVQLALILPLPFCGPNILDNFYCDVPQVLRLACTDTSLLEFLMISNSGLLVIIWFLLLLMSYTVILVMLRSHSGKAKRKAASTCTTHIIVVSMIFIPCIYIYARPFTPFPMDKAVSISYTVMTPMFNPVIYTLRNQDMKAAMRRLGKCLVICRE.
For Research Use Only | Not For Clinical Use.
Online Inquiry