AibGenesis™ Mouse Anti-OR4K2 Antibody (CBMOAB-53488FYA)


Cat: CBMOAB-53488FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53488FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO53488FYA 100 µg
MO-AB-08236W Monoclonal Cat (Felis catus) WB, ELISA MO08236W 100 µg
MO-AB-09131Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09131Y 100 µg
MO-AB-15469W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15469W 100 µg
MO-AB-16510Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16510Y 100 µg
MO-AB-32513W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32513W 100 µg
MO-AB-60666W Monoclonal Marmoset WB, ELISA MO60666W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO53488FYA
SpecificityThis antibody binds to Rhesus OR4K2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR4K2 Antibody is a mouse antibody against OR4K2. It can be used for OR4K2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR4K2
UniProt IDF7HHX4
Protein RefseqThe length of the protein is 314 amino acids long.
The sequence is show below: MDVANKSTMFEFVLLGLSNSWELQMVFFMVFSLLYVATMVGNSLIVITVIVDPHLHSPMYFLLTNLSIIDMSLASFATPKMITDYLTSHKTISFDGCLTQIFFLHLFTGTEIILLMAMSFDRYIAICKPLHYASIISPQVCVALVVASWIVGIMHSMSQVIFALTLPFCGPNEVDSFFCDLPVVFQLACVDTYVLGLFMISTSGIIALSCFIVLFHSYVIVLVTVKHHSSRGSSKALSTCTAHFIVVFLFFGPCIFIYMWPLSSFLTDKILSVFYTIFTPILNPIIYTLRNQEVKIAMRKLKNRFLNFNKAMPS.
For Research Use Only | Not For Clinical Use.
Online Inquiry