AibGenesis™ Mouse Anti-OR5I1 Antibody (CBMOAB-53528FYA)


Cat: CBMOAB-53528FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53528FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO53528FYA 100 µg
MO-AB-04918W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04918W 100 µg
MO-AB-08301W Monoclonal Cat (Felis catus) WB, ELISA MO08301W 100 µg
MO-AB-09190Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09190Y 100 µg
MO-AB-10070W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10070W 100 µg
MO-AB-35313W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35313W 100 µg
MO-AB-60713W Monoclonal Marmoset WB, ELISA MO60713W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO53528FYA
SpecificityThis antibody binds to Rhesus OR5I1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR5I1 Antibody is a mouse antibody against OR5I1. It can be used for OR5I1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR5I1
UniProt IDF7FTS2
Protein RefseqThe length of the protein is 314 amino acids long.
The sequence is show below: MEFTDGNYTLVTEFIVLGFPTCPELQIVLFLIFLTLYGIILIGNIGLILLIRIDPHLQTPMYFFLSNLSFVDLCYSSVIVPKMLVNFLSENKSISYYGCALQFYFFCTFADTESFILAAMAYDRYVAICNPLLYTVVMSRGICMWLIVLSYVGGNMSSLVHTSFAFILKYCDKNVINHFFCDLPPLLKLSCTDTTINEWLLSTYGSSVEIICFIIIIISYFFILLSVLKIHSTSGRKKTFSTCASHLTSVTIYQGTLLFIYSRPSYLYSPNTDKIISVFYTIFIPVLNPLIYSLRNKDVKDAAKNVLRSKVDSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry