AibGenesis™ Mouse Anti-OR5J2 Antibody (CBMOAB-53529FYA)


Cat: CBMOAB-53529FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53529FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana) WB, ELISA MO53529FYA 100 µg
MO-AB-00991L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00991L 100 µg
MO-AB-07866W Monoclonal Cat (Felis catus) WB, ELISA MO07866W 100 µg
MO-AB-11345W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11345W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana)
CloneMO53529FYA
SpecificityThis antibody binds to Rhesus OR5J2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR5J2 Antibody is a mouse antibody against OR5J2. It can be used for OR5J2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR5J2
UniProt IDF7FTU2
Protein RefseqThe length of the protein is 256 amino acids long.
The sequence is show below: IVLILQCHHTELIPISISLTGIKKQKSMAEVNFTLVTEFILLGLTDRAELKMVLFMLFLLIYIISLVGNLGILFLIYVTPKLHTPMYYFLSCLSFVDACYSSVFAPKMLLNFFVEQETISFSACIVQYFLFVSLLTTEGFLLATMAYDRYVAIVNPLLYKVAMTKMVCIVLLFGSCVGGLINSLTHTIGLVKLSFCGPNVISHFFCDLPPLLKLSCSDTSMNELLLLIFSGIIAMLTFLTVVISYIFIVAAILRIR.
For Research Use Only | Not For Clinical Use.
Online Inquiry