AibGenesis™ Mouse Anti-OR5W2 Antibody (CBMOAB-53540FYA)


Cat: CBMOAB-53540FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53540FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO53540FYA 100 µg
MO-AB-09197Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09197Y 100 µg
MO-AB-15503W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15503W 100 µg
MO-AB-60715W Monoclonal Marmoset WB, ELISA MO60715W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO53540FYA
SpecificityThis antibody binds to Rhesus OR5W2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR5W2 Antibody is a mouse antibody against OR5W2. It can be used for OR5W2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR5W2
UniProt IDF7FTR7
Protein RefseqThe length of the protein is 310 amino acids long.
The sequence is show below: IDWENCSSLTDFFLLGITNNPEMKVTLFTVFLAVYIINLSANLGMIVLIRMDYQLHTPMYFFLSHLPFCDLCYSTAIGPKMLVDLLSKNKSIPFYGCALQFLVFCIFADSECLLLAVMAFDRYKAISNPLHYTVSMSSRVCYLLLTGVYLVGIADALIHTTLAFRLCFCGSNEINHFFCDIPPLLLLSCSDTQVNELVLFTVFGFIELSTISGALISYCYIILSVLEIHSAEGRFKAFSTCTSHLFAVAIFQGTLLFMYFRPSSSYSLDQDKMTSLFYTLVVPTLNPLIYSLRNKDVKEALKKLKNKILF.
For Research Use Only | Not For Clinical Use.
Online Inquiry