Mouse Anti-OTOL1 Antibody (CBMOAB-53656FYA)


Cat: CBMOAB-53656FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53656FYA Monoclonal Rhesus (Macaca mulatta), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO53656FYA 100 µg
Inquiry
MO-AB-12693Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12693Y 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), O. mykiss (Oncorhynchus mykiss)
CloneMO53656FYA
SpecificityThis antibody binds to Rhesus OTOL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted glycoprotein with a C-terminal complement Cq1-like globular domain that belongs to the C1q/tumor necrosis factor-related protein (CTRP) family. The encoded protein is expressed in the inner ear and forms a multimeric complex called the otoconia, together with cerebellin-1 and otoconin-90, as part of the otoconial membrane. It contains extensive posttranslational modifications including hydroxylated prolines and glycosylated lysines. Naturally occurring mutations in this gene are associated with abnormal otoconia formation and balance deficits resulting from vestibular dysfunction. (From NCBI)
Product OverviewMouse Anti-Rhesus OTOL1 Antibody is a mouse antibody against OTOL1. It can be used for OTOL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOTOL1
UniProt IDF7FPW3
Protein RefseqThe length of the protein is 287 amino acids long.
The sequence is show below: KGERGDQGVPGYPGKPGAQGEPGPKGDKGNTGLGGVKGQKGSKGDTCGNCTKGEKGDQGAMGSPGLHGRPGAKGEKGEMGDKGFCGDSGERGGKGQKGEVGMKGEKGSKGDSGMEGKSGHSGLPGAKGDPGVKGEKGELGPPGLLGPTGPKGDTGSKGIRGPIGKKGFRGFKGSKGEVARVPRSAFSAALLKPFPPPNIPIKFEKVLYNDQGNYSPVTGKFNCSIPGTYVFSYHVTVRGRPARISLLAQNKKQFKSRETLYGHEIDQASLLIILKLSAGDQVWLEVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry