AibGenesis™ Mouse Anti-OVOL1 Antibody (CBMOAB-53677FYA)


Cat: CBMOAB-53677FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53677FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Zebrafish (Danio rerio) WB, ELISA MO53677FYA 100 µg
CBMOAB-91130FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91130FYA 100 µg
MO-AB-17401R Monoclonal Cattle (Bos taurus) WB, ELISA MO17401R 100 µg
MO-AB-27127W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO27127W 100 µg
MO-AB-37907W Monoclonal Goat (Capra hircus) WB, ELISA MO37907W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Zebrafish (Danio rerio)
CloneMO53677FYA
SpecificityThis antibody binds to Rhesus OVOL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a putative zinc finger containing transcription factor that is highly similar to homologous protein in Drosophila and mouse. Based on known functions in these species, this protein is likely involved in hair formation and spermatogenesis in human as well. (From NCBI)
Product OverviewMouse Anti-Rhesus OVOL1 Antibody is a mouse antibody against OVOL1. It can be used for OVOL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOVOL1
UniProt IDF7FEA8
Protein RefseqThe length of the protein is 267 amino acids long.
The sequence is show below: MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSVAPGPCVVAQLPSEDMGPLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTCHICQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL.
For Research Use Only | Not For Clinical Use.
Online Inquiry