AibGenesis™ Mouse Anti-OXCT2 Antibody (CBMOAB-53683FYA)
Cat: CBMOAB-53683FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-53683FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Guinea pig (Cavia porcellus), Marmoset | WB, ELISA | MO53683FYA | 100 µg | ||
| MO-AB-17406R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17406R | 100 µg | ||
| MO-AB-42268W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42268W | 100 µg | ||
| MO-AB-60824W | Monoclonal | Marmoset | WB, ELISA | MO60824W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Guinea pig (Cavia porcellus), Marmoset |
| Clone | MO53683FYA |
| Specificity | This antibody binds to Rhesus OXCT2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene catalyzes the transfer of a CoA group from succinate to acetoacetate and is an important enzyme in ketone body catabolism. The encoded protein localizes to the mitochondrion. This gene is intronless, and a pseudogene of this gene is located elsewhere on chromosome 1. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus OXCT2 Antibody is a mouse antibody against OXCT2. It can be used for OXCT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Succinyl-CoA:3-ketoacid-coenzyme A transferase 2, mitochondrial; OXCT2 |
| UniProt ID | H9F2G4 |
| Protein Refseq | The length of the protein is 54 amino acids long. The sequence is show below: DRIITEKAVFDVHRKRGLTLTELWEGLTVDDVRKSTGCAFAVCPNLRPMQQVAP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry