Mouse Anti-P2RY10 Antibody (CBMOAB-53711FYA)


Cat: CBMOAB-53711FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53711FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO53711FYA 100 µg
CBMOAB-91194FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91194FYA 100 µg
MO-AB-05938H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05938C 100 µg
MO-AB-17429R Monoclonal Cattle (Bos taurus) WB, ELISA MO17429R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO53711FYA
SpecificityThis antibody binds to Rhesus P2RY10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the family of G-protein coupled receptors that are preferentially activated by adenosine and uridine nucleotides. There is a pseudogene for this gene nearby on chromosome X. Multiple alternatively spliced transcripts have been observed. (From NCBI)
Product OverviewMouse Anti-Rhesus P2RY10 Antibody is a mouse antibody against P2RY10. It can be used for P2RY10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative P2Y purinoceptor 10; P2RY10
UniProt IDH9Z2Z2
Protein RefseqThe length of the protein is 339 amino acids long.
The sequence is show below: MAYLDKYTEIFKMGSNSTSTAEINCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRGLCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIIVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPIVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG.
For Research Use Only | Not For Clinical Use.
Online Inquiry