AibGenesis™ Mouse Anti-PABPC4L Antibody (CBMOAB-53731FYA)


Cat: CBMOAB-53731FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53731FYA Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO53731FYA 100 µg
MO-AB-04963W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04963W 100 µg
MO-AB-60884W Monoclonal Marmoset WB, ELISA MO60884W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO53731FYA
SpecificityThis antibody binds to Rhesus PABPC4L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PABPC4L Antibody is a mouse antibody against PABPC4L. It can be used for PABPC4L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPABPC4L
UniProt IDF7EVC8
Protein RefseqThe length of the protein is 309 amino acids long.
The sequence is show below: SLYVGDLHADVTEDLLFRKFSAAGPVLSIRICRDQVTRRSLGYAYVNFLQLTDAQKALDTMNFDIIKGKSIRLMWSQRDAYLRRSGIGNVFIKNLDKSIDNKTLYEHFSGFGKILSSKVMSDDQGSKGYAFVHFQNQSAADRAIEEMNGKLLKSCKVFVGRFKNRKDREAELRSKASEFTNIYIKNFGGDMDDERLKDVFSKYGKTLSVKVMTDSSGKSKGFGFLKRERIRGYQGVKLYVKNLDDTIDDEKLRNEFSSFGSIIRVKVMQQEGQSKGFGFICFSSLEDATKAMIEMNGCFLGSKPISIAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry